DPCstruct | MC7667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 203 ± 23 aa |
| Standard deviation of domain lengths | 22.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1R0I2 | 2-188 | YYTAVEQIRLHKEFDNYLSSGELDHSMDEFISSKDEFVEDLIRDESTMAQFSDLNHALLKLSLERRADVLENQQQICIYSECLQRLL… |
| A0A453GD05 | 8-200 | YYTAKKQVRLHEEFDNYLATCTWDDAIDLSSFMESARRDDEKFAELDPDLAKMSFERMTNIAERKHKMNSYTQSLRDLNDEVKGQLA… |
| A0A0A9V157 | 101-367 | None |
| A0A6V7NP42 | 64-269 | None |
| K3YE92 | 538-741 | None |
| M7YES3 | 38-244 | None |
| A0A6P5GZJ8 | 11-208 | None |
| A0A368RTM5 | 929-1133 | None |
| A0A3B6LJC7 | 539-749 | None |
| A0A287M088 | 33-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.