DPCstruct | MC7666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.42 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0BSN3 | 1-86 | MPKFTWLFIATYADPKAIPVVVRTQADTEEEARQQLNGGFTLTFAAKIRTKSPFNICWNDMDNMTLWSITGTDTSCARKIAGSHHA |
| A0A4V1AA33 | 1-80 | MAGTQHTQTHPKFTWLFLGIPKGQNCMPVVIRIAADTEEEAREWYSRWDLTFAAKIRSECSLYQYASGAYELNVMGVHHA |
| A0A898GZ46 | 79-165 | None |
| A0A1X7KAX3 | 172-248 | None |
| A0A5B0K844 | 1-89 | None |
| A0A744JSR7 | 14-102 | None |
| A0A377P483 | 510-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.