DPCstruct | MC7660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 159 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512T041 | 8-154 | ARAALQVAAWRDTIGEMPSEVLVGLALDAVVAGMDGPRLIELAGADSSDPRDLRDLWQAVVVEQGIERADEQNALWQLVRHTANGVV… |
| A0A7Z0WET4 | 6-165 | PALRARVLRLNADLTLEELDPEPVVWLACDLLVAGADTPALCELAGESPTGLTLADAEPLVRRMLTELGVEPVDTVRAPRIVAHDIA… |
| A0A268ENJ7 | 2-158 | None |
| A0A4R6K3P3 | 2-147 | None |
| A0A1S2GX01 | 55-206 | None |
| A0A7Y5RF07 | 1-151 | None |
| A0A2E4PIR9 | 37-207 | None |
| A0A0Q9MUU2 | 1-144 | None |
| A0A1H9CX67 | 2-147 | None |
| A0A347Q3H0 | 12-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.