DPCstruct | MC766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 364 ± 65 aa |
| Standard deviation of domain lengths | 65.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.87 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF18211- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6QT59 | 2-299 | HTQTLQVTLRCLLQGLEEMGRRGGGQGDWGQLRKLGPQWAPVLDGLQEPLPQNRVTDLAHLARRLSTAGHETEGAGGTVDPLTPLAT… |
| A0A832QTW7 | 1-402 | MNNLIQTIIDKKKDILTGEIGALLHDIGKCHPYFIGKNSIENTPTNFDHTNIDEFLGKELINLIKDEKFKLKINNNETDVYKIITEH… |
| A0A5C7SVY9 | 4-516 | None |
| A0A166ESA5 | 1-332 | None |
| A0A426TUK4 | 3-432 | None |
| A0A7C4RUS6 | 3-243 | None |
| A0A1W9TNG8 | 425-746 | None |
| A0A7V0YG78 | 13-374 | None |
| A8F6I3 | 260-654 | None |
| A0A7Z9WQ81 | 1-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.