DPCstruct | MC7659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 4.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 87.47 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0023- CL0266- PF00124- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453TBI7 | 1-53 | WGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREP |
| A0A5D2HLL2 | 1-67 | MTAILERRESESLWGRFCNWITVTENRLYIGWFGVLMIPTLLIATSVFIISFIAAPPVDIDGIREPD |
| A0A2C9VE89 | 1-63 | None |
| A0A1R3L268 | 1-59 | None |
| Q7XCI7 | 2-66 | None |
| A0A2G3B260 | 150-203 | None |
| A0A0X8WQU2 | 24-81 | None |
| A0A287U3C2 | 6-66 | None |
| A0A7J9HZ61 | 2-54 | None |
| A0A7J7MWA8 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.