DPCstruct | MC7656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 211 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0SWK6 | 227-412 | FAKLSEHPVRVIVSDDLQRPRLTVLFRLLLAIPHFVWLLLWSIATFVAAVVAWFAALATGRVPSALHRFLAAYVRYVLHLFAFLYLV… |
| A0A537ZEP0 | 169-368 | GGPPPPPAAYGGVDYPVDFQVDYPEAGIARWRALFQGLLLIPHLFVLLFVYIGVLVVWLIAWFAILITGRYPQGMFNFLAGALKWTN… |
| A0A419E021 | 73-292 | None |
| S7X8M3 | 410-620 | None |
| A0A6N2DNS0 | 385-623 | None |
| A0A538H3H6 | 7-210 | None |
| A0A7C7D1V4 | 3-211 | None |
| A0A535DPL9 | 43-241 | None |
| A0A7C4N2N5 | 361-567 | None |
| A0A7W0HNS0 | 4-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.