DPCstruct | MC7654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 147 ± 16 aa |
| Standard deviation of domain lengths | 15.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426SAA3 | 91-202 | GVRGLAIQPEYGGRSDFYTGTFSLRFRLLGRQLAPGCTIGATAPVDFRLKRSGPSTWVSQDPPLIEFSAYDDTFAAPAAERCGPLAP… |
| A0A537YT72 | 25-189 | QLVPGGVIGLTGLDWLVNFLSIESLQLFAVTELAGTPVVAEEVITLPIKVHLVNPALGNNCYVGSSSNPITLNLTFNTTNPPPPNKP… |
| A0A358STN2 | 14-150 | None |
| A0A1C4MLJ2 | 7-153 | None |
| A0A652YNR0 | 1-153 | None |
| A0A7Y9ELG0 | 2-138 | None |
| H0EBW5 | 51-224 | None |
| A0A4V5ZPP4 | 23-187 | None |
| E9SZD0 | 213-343 | None |
| A0A3M2LPM3 | 41-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.