DPCstruct | MC7651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 86 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6QZ54 | 1-56 | MNKKEIPSTKIESIIKPKCNLFELVQYQCNIKDDRVVCSPFVRIFKRCSGKPTVEI |
| A0A177V4A0 | 1-84 | MAASSEAPVAKKPSKPDCVLREITQYDCDIRVNKGIRCFPARRIFRICEGRPAVEVTHVVEWDSNDKPILKPEFQTAMPPSSHW |
| A0A854QFR3 | 3-83 | None |
| A0A1C7MNQ0 | 1-70 | None |
| A0A0J1AZP6 | 2-89 | None |
| A0A5C2SRG5 | 1-86 | None |
| A0A177VFA9 | 10-97 | None |
| A0A0F7SL20 | 8-112 | None |
| A0A0L6WN38 | 4-78 | None |
| A0A5E3WRF0 | 1-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.