DPCstruct | MC7650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 460 ± 84 aa |
| Standard deviation of domain lengths | 83.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5VIK4 | 9-401 | INWCSQVRAAGMDVPIIPGIMPITTYAAFLRRAQWGQISIPQHFSSRLDPIKDDDELVRDIGTNLIVEMCQKLLDSGYVSHLHIYTM… |
| A0A177V0D5 | 159-764 | CLHLTCTNVTRTSLEHTLKKAKEYGIRNILALRGDPPRGSEYWTPADASFQQATDLIRFIREHYQDYFCIGVAGYPESHPDAPSNQD… |
| A0A6A5VVZ0 | 82-650 | None |
| A0A4U0VEC5 | 80-591 | None |
| A0A146H906 | 80-584 | None |
| A0A7D9LEC5 | 2-288 | None |
| A0A3D8S6K6 | 341-922 | None |
| A0A7S4PPB0 | 2-365 | None |
| A0A7S0JU46 | 25-463 | None |
| A0A162I9I6 | 12-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.