DPCstruct | MC7649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5XDH1 | 2-84 | AASYPETPTRAQQADVSSFIGLLARLYPCWVCAKDLEAHVKRDAPRVGSRGDLSRWLCQAHNDVNRKLGKPLFDCDKWDERWR |
| A0A177UCU3 | 210-362 | LPKSKATPATTSAEGTSSNSSKSSSSTSAAQIEECPPDVEALGHATWTLLHSAAAYYPSDPSPAQQTSMRNFLQALPDVYPCSSCAE… |
| A0A5J4N804 | 113-239 | None |
| A0A0L0RYX7 | 42-218 | None |
| A0A0F8VZL6 | 3-116 | None |
| A0A6C0F9B8 | 7-125 | None |
| A0A2E5JAT4 | 13-110 | None |
| A0A0V0S7F8 | 64-177 | None |
| A0A5N5I8C9 | 10-164 | None |
| A0A3N4LJP2 | 37-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.