DPCstruct | MC7648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 397 ± 47 aa |
| Standard deviation of domain lengths | 46.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8QJR5 | 520-859 | QGEYVWLGELRNRQCSNKDIARLLVEQLEDAPWIYFEPKIPRAEIIQPTLHVPQCVHYGGRSLSSTQKGKSSTPSFVSAKHSSVAFD… |
| A0A0D2EN37 | 1-392 | MLSLKQPPVRLCRTLLSLSLSLSLSLSEVEQQIKKWQDTARKGNFDADMHILDPASHQAWLQFLEKDIVDNSEFFHCRGYYDLNDHG… |
| A0A2S7QSN9 | 17-433 | None |
| A0A1V6TZR6 | 142-553 | None |
| A0A370U1V4 | 33-484 | None |
| A0A1V6RGG4 | 15-303 | None |
| A0A2P4ZQZ0 | 1-367 | None |
| A0A0B4I176 | 15-517 | None |
| A0A1L7XY02 | 11-449 | None |
| A0A6A6CAZ7 | 230-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.