DPCstruct | MC7646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2WIZ4 | 639-760 | RLLERLRWWERYVADNGGEMNNNPSPGNVAGGITTILEKSLGAVSKGGRSTLRAIYDYAEPVRASGLVFMDTPGYDPVSATGQIAGG… |
| A0A7X3AQ65 | 21-127 | GLSQVNPTPGNKAGGLTTMTEKNLGSFKTQGHRRILGILDCGDPVPGAGAWGINQAQGANDAYASTTLAMSGCHICLFTTGRGNPIG… |
| A0A2X3CUR9 | 16-103 | None |
| A0A1V6FGU8 | 762-864 | None |
| A0A858NAX6 | 1-127 | None |
| A0A168PD76 | 32-136 | None |
| A0A7C7VQG5 | 63-167 | None |
| R5PMS8 | 18-141 | None |
| A0A285D0P7 | 2-94 | None |
| A0A7X9HV56 | 221-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.