DPCstruct | MC7644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 16.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07275 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6HP85 | 1-76 | MLEAFITNLGRYNEGYLDGAYLKLPAEKEDVQALLKKIHVDGIRYEEIFITDYETDVPGLYDCLGEYDSIDELNHS |
| A0A3D4D9V8 | 3-101 | VFEAYITNLGKYAEGQLVGETLKFPATTEEVQSLLKNIGVDGVRYEEFFITAFDGDVMGLYDYLTEYENLDELNHLAHLISELDSDE… |
| A0A2V2D3P8 | 1-105 | None |
| A0A416JJB5 | 168-283 | None |
| A0A7X2NPM6 | 11-122 | None |
| A0A158SIL3 | 2-85 | None |
| A0A1Y4BDN2 | 3-118 | None |
| A0A4V6NBQ0 | 318-405 | None |
| A0A1Q6L0U1 | 214-332 | None |
| A0A4R1QP94 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.