DPCstruct | MC7642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 163 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 19.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09548 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0LYR5 | 2-168 | KFVGMIFIFLAGVWAGMAASSALNKRVSVFEQLERFVVYLETQIRYSAAPIHEILKQSTKGEFSKLLFLSETANRMCKGECPSDAWE… |
| A0A3D4D3P1 | 1-163 | MLRLTGSALILGAVLWLQRSFHLRTLLRQRTLRALSGAFLALESAVRLTLTPLPALLRHLSCEPEAAGFFEGVTANLARGEPLASAW… |
| A0A226C0Y3 | 3-173 | None |
| A0A2A6ZWY9 | 8-154 | None |
| A0A3D1X946 | 68-225 | None |
| A0A252F761 | 59-230 | None |
| R5WPZ3 | 2-147 | None |
| A0A1Y4FEE1 | 22-193 | None |
| R9KYS4 | 3-172 | None |
| A0A1M2ZAY8 | 3-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.