DPCstruct | MC7641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 153 |
|---|---|
| Mean domain length (aa) | 165 ± 41 aa |
| Standard deviation of domain lengths | 40.83 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | PF02245- CL0279 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3BIM2 | 6-190 | ISYYQQDDVVALSRDLLGKYLFTNINDEGLTGGIIVETEAYAGATDKASHAHMNRFTNRTKIMYEAGGVAYVYLIYGFYYLLNFVTN… |
| A0A3D2YGF0 | 10-168 | KFFERDAAAVAKDLLGGTILYRGKEGAHRYWITETEAYYHDEQDKRGKLICYGAGKSKSAAQSDVSAPLFSKPGTWCVYGGQLLLSV… |
| A0A5J6Z846 | 200-416 | None |
| A0A0B7NHP4 | 9-176 | None |
| I1CGY9 | 11-164 | None |
| A0A482VXK8 | 7-194 | None |
| H9GGQ2 | 1-143 | None |
| A0A857JFV3 | 271-460 | None |
| A0A3D5LNT2 | 14-191 | None |
| A0A168H0T5 | 116-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.