DPCstruct | MC764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 164 ± 17 aa |
| Standard deviation of domain lengths | 17.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 20.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7V7Y1 | 4-188 | LIVAGLALSTVGTVAQFQAQQAQASALKQQGEYTRQIYEYNASLKRQQAGLAKQLAEKNARGQEEQGMIDIGHIRAGMAASGVDVNT… |
| A0A1L3ZV77 | 3-143 | QLAGAAAIGGTLLDAGGTILSSRAQAKDLKRQAGQLDDQAGDTRASSQRAAREERRQARLASSRGLAVAAASGGGASDPTVVNMMAD… |
| A0A349XN19 | 17-184 | None |
| A0A7V8AIL6 | 11-200 | None |
| A0A0F9RRB0 | 22-205 | None |
| A0A2G5R176 | 4-165 | None |
| A0A523Z229 | 9-161 | None |
| A0A2D8XMA8 | 2-151 | None |
| Q2KZ31 | 13-183 | None |
| A0A4P6GRG5 | 11-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.