DPCstruct | MC7638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 358 ± 50 aa |
| Standard deviation of domain lengths | 49.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.66 |
| Pfam Score | 47.69 |
| Assigned Pfam label(s) | PF05076- PF12470- PF11979- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9XPM2 | 18-328 | LYPDVEPKHYGTLHRFALGGPDPLDGVSFYPRDEPVPHWHVVGYGMSELYAKESDNPDESGWGFEFTIRPARDIGETEPPMWAASLL… |
| A0A7I8W4Y4 | 18-372 | DPIDGILIFLCREETVKKISKHWHYVGLGLSDIHSTEKSQTEKTSLELTFRLKYAEESQPPVWPLNILYSLSEYMLESGNLIRVGDH… |
| A0A813RPR6 | 13-366 | None |
| A0A1I8F2S8 | 424-787 | None |
| A0A6V7W678 | 358-659 | None |
| A0A654HT31 | 400-807 | None |
| A0A182EGN7 | 165-513 | None |
| A0A158QEP6 | 466-932 | None |
| A0A0B1RR25 | 11-345 | None |
| A0A6V7VN49 | 631-1084 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.