DPCstruct | MC7637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.63 |
| Pfam Score | 98.29 |
| Assigned Pfam label(s) | PF02064- PF15020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A421JMJ6 | 1-159 | MSSKTLTFTAIVATAVVGYAVYFDYRRRNSAEFRKSLKKRANKQQKLKEKKDAETKQIKLEAVKSALIADLQANPIPTDLSEREAFF… |
| A0A7I8W1L8 | 5-147 | TALIVAAASAGVSFLAYCIYFDRKRRSHPDFRKKLLERRRIAKGGSRSGINTEFPDPSNPDSFHQFFLQEIQKGEELLATGQMEEGV… |
| A0A1Y1WLQ7 | 4-152 | None |
| A0A1X2GGE2 | 4-157 | None |
| A0A4U5U3N7 | 207-385 | None |
| A0A5J4NBR4 | 40-174 | None |
| A0A1J1IF69 | 10-152 | None |
| A0A444UIC3 | 5-151 | None |
| A0A1I8FXI2 | 2-158 | None |
| A0A6P5W2V2 | 4-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.