DPCstruct | MC7636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 433 ± 57 aa |
| Standard deviation of domain lengths | 56.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7TDY9 | 132-533 | RLVYADFLPKCRVEGNHKLRILPVFEDFTTLMSILNDWLMKNPAYQVVRAESIERKVDQTGQWEFDSMLYFQAAFGKTTYIRGIRVW… |
| A0A7I8W164 | 25-481 | FRCLYKDFIPKCIKDSNDFSATIYQSLSDLVDDANAWLRTENMYRVTGCESIGATLPNASYNIGTTVNPDYCKLLVQGDEDKKKYPT… |
| R7TJ12 | 61-454 | None |
| F6Y0R0 | 268-700 | None |
| A0A6P9AM91 | 29-545 | None |
| T1JS27 | 44-397 | None |
| R7ULL1 | 21-506 | None |
| A0A7R9FRQ1 | 1-375 | None |
| T1IXU7 | 512-891 | None |
| A0A6P6YHK9 | 2-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.