DPCstruct | MC7635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5IRX2 | 2-71 | KEPLTQKELQEMAGKPVYCPELEVYGIVKYETKGRWAGRPFLVGVWHQYGAAVNFEYNILERGLKCYEID |
| A0A3R6XEY5 | 3-83 | KREPLDQEPLTIEELKTMAGLPVWCPDEEAYGIVMCDSIGQWAGIPFLHGVWYHDGIGVEFNHNIIGRKLKCYRVIDEKET |
| A0A1Y4RGR2 | 76-142 | None |
| A0A1C5ZJX2 | 1-70 | None |
| A0A7X3ARL6 | 34-112 | None |
| U2BJG1 | 17-96 | None |
| A0A1C6EML0 | 53-137 | None |
| C0DA49 | 39-111 | None |
| A0A1Y3SH30 | 53-118 | None |
| G5FH98 | 72-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.