DPCstruct | MC7632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 21.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 61.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0HBH7 | 380-551 | DSKAPMEDTILVGDDLMLGPPSPLIPPEIASHVLEGVDLCDGILRNLFYCLQVHGVEPFCQQEISLYQECAEQRDKELRQRLQDSEH… |
| A0A2P6QG94 | 4-158 | DSQPTMEETILVGDDLMMGPPSPIIPPEIASHVLEGVDLCDGILKNLFLCLQINDIEPFCQDELAMYKQCAEKRDRELRKRLQDSEQ… |
| A0A5J5V324 | 6-138 | None |
| A0A1D6EBN7 | 1-171 | None |
| A0A1D6EBM8 | 1-141 | None |
| A0A2U1M0G8 | 73-208 | None |
| A0A834L6F1 | 1-163 | None |
| A0A834L3H8 | 54-194 | None |
| A0A0E0JF29 | 29-200 | None |
| A0A835RNV4 | 100-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.