DPCstruct | MC7631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 2.89 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 55.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452ZHY6 | 56-118 | YHIDSPDNNPNMPWEFTKDNMEKVNEILSHYPSNYKQSGIIPMLDLAQQQHGGWVPVAAMDAI |
| A0A7R9BTT3 | 728-789 | VHRDSKENNPNTPFEFTSENMKRAEAIMENYPVGHKRGAVIPLLDLAQRQHGWLPISAMHKV |
| D3BVI2 | 36-98 | None |
| A0A4R0RCW8 | 636-698 | None |
| A0A4Z2DEZ2 | 34-95 | None |
| M1W2Q5 | 548-609 | None |
| A0A5J4YVM0 | 103-165 | None |
| A0A4S4LBV2 | 336-402 | None |
| A0A0D8YDP4 | 26-87 | None |
| A0A7G5KI22 | 113-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.