DPCstruct | MC7630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 187 ± 30 aa |
| Standard deviation of domain lengths | 29.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0489- PF09273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804JSE0 | 26-233 | FLTLSLPPLAEDDPFFAEKKRLLNARELKFKFLVPLHSSAEEVLQIADQMVQTARISCMNEKELYFAGDDDIGPFSPRNEIESLNLM… |
| A0A7J0H5I1 | 1-180 | MQLHLSNKTVENDEYLLVLKPSEEDPLFEIKKIELYFGGVDTNSSGVLYNPRIELEALHSILSLIDKTLSSGNHALTSILQDLRDVC… |
| A0A182EJI7 | 1-151 | None |
| A0A6A6MBU1 | 22-199 | None |
| G5AK31 | 8-147 | None |
| A0A7J7LSE2 | 19-225 | None |
| A0A1S3Y8V2 | 1-143 | None |
| A0A7G2EA16 | 303-499 | None |
| A0A6A1UWN5 | 9-226 | None |
| X1WX75 | 20-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.