DPCstruct | MC763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 142 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174V4J2 | 299-435 | LIKQLNEFYSQNAVLFINSKHIFDNESDVQNNFSKVKMLYQDREISNYLFSDSKSNILIQASDVIIGVFGKLFSFIKSIDILSLDDV… |
| A0A374RGB2 | 11-150 | NNEPYMLIQEYYLFYSERCEIFSKSRHIFDEEFTVQKQMSELELHENGVQFKNWQFVKSHENIYVQISDLIAGLLRKLFMFLDDNSL… |
| A0A449BGN6 | 5-124 | None |
| A0A435BNK3 | 88-215 | None |
| A0A7Y0WJP2 | 1-131 | None |
| A0A323TW86 | 108-266 | None |
| A0A7Y7Z024 | 154-291 | None |
| A0A739DTB1 | 13-164 | None |
| A0A2B2LWC1 | 80-218 | None |
| A0A5Q4ZY46 | 3-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.