DPCstruct | MC7629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 503 ± 83 aa |
| Standard deviation of domain lengths | 83.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087X8A1 | 70-533 | LQQPSFLLANLKADATTKPLIQRCQDLLKIIDEYPAKELHLIFPWLVENVFGSLDGVISGWNLRLLHSRSNEFNLVLDFLSPSGPMM… |
| A0A7J0H0C6 | 8-515 | ADLASAILAAASPPQIAAACDAIETFFHQHGPDQARWFFSVTFPTLICKIFGFDDSSPPPPHRPPPPQSPNGWINAVSNDSELAARV… |
| A0A2S2QZU4 | 42-501 | None |
| A0A1B6CMT9 | 10-513 | None |
| A0A225X081 | 30-428 | None |
| S4RG54 | 14-399 | None |
| A0A480UCH3 | 25-510 | None |
| A0A0B7N6A4 | 7-510 | None |
| A0A565C3P9 | 26-566 | None |
| W5JV96 | 19-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.