DPCstruct | MC7628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 48.31 |
| Pfam Score | 80.77 |
| Assigned Pfam label(s) | CL0110- CL0036- PF16881 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0GYJ3 | 28-136 | RDPNVKKPEWLRQRAPQGERFEEVKESLSRLNLNTVCQEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPD… |
| A0A5C8X411 | 2-93 | ATKNEEILRKPDWLKIKLNTNENYTGLKKMMREKNLNTVCEEAKCPNIHECWGARRTATFMILGAVCTRACRFCAVKTGLPNELDLN… |
| A0A0B8PGB0 | 18-130 | None |
| A0A5N5TE65 | 326-454 | None |
| A0A6J5ZIJ9 | 143-248 | None |
| A0A162D756 | 73-199 | None |
| A0A183HMR9 | 5-101 | None |
| N1QY99 | 846-958 | None |
| A0A6P2E0T3 | 29-132 | None |
| A0A2A2KSC1 | 29-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.