DPCstruct | MC7627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 152 ± 34 aa |
| Standard deviation of domain lengths | 34.48 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087SJ06 | 6-157 | KEGLLEHLSNRRAGLMGTGMPAPLQTLPEEGSASTTRIPYSDAQLASRIAWQPLPLARLVEALLPLFSAPGSNGARMGHDVLMSRIC… |
| A0A7J0GU75 | 2-124 | AEQLTREERETRIIALSQELEGLFKYYKEVVDEKLNLDSRKCGSSNSTIVCLLEEGNLSLSKLVEEIYEKVKVKSGMTPASVKSSVL… |
| A0A7J7GV08 | 1-110 | None |
| A0A287QL98 | 1-111 | None |
| F6GZC8 | 1-106 | None |
| A0A2U1QLZ5 | 3-175 | None |
| A0A7J0F648 | 22-166 | None |
| A0A6N2AZS7 | 1-184 | None |
| A0A4U5MXM5 | 28-174 | None |
| A0A287WST9 | 30-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.