DPCstruct | MC7624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 248 ± 19 aa |
| Standard deviation of domain lengths | 19.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354GV08 | 6-231 | TLEIHPAIGIARVGSSQEFFLGPEPGLAIETSRRDATPSKLLKRQAARFRVYSCTRNPQGVIVSFEELTPEKATITWTVHLVNRKAA… |
| A0A366CXF7 | 1-255 | MALSVHPSIGIARLGNANTDNFVLNPIKIGGLPYEHDADLKPTTTVVNFKDEAGCIRRQGQVFKVFDTSDEELTLDSPNVKNIEWTV… |
| A0A7T1MDT1 | 30-273 | None |
| A0A433QEZ7 | 1-236 | None |
| A0A2Z6R9C4 | 5-260 | None |
| R9B1L3 | 211-479 | None |
| A0A4Q7QC51 | 4-203 | None |
| A0A7W7Q8B2 | 4-269 | None |
| X6BZU4 | 5-251 | None |
| A0A6P1BJH9 | 15-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.