DPCstruct | MC7623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 7.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3ZRW0 | 90-192 | LGVFGGALLGGSQGLARSMFGQMVPETRSAEFFGFFGFFGKVAALLGPLIYSVMTVWFDSRVGIFAISLLIVAGAIMLRRVDVEDGI… |
| A0A7J4CT45 | 2-87 | LARSLFGQMVPETRSTEFFGFFGFFGKVAAFIGPMLYTVLAVMFDSRVAISSLAVLIIAGTIMMFWVDVEDGIAVATAEDARIRGI |
| A0A7V9U8L5 | 78-163 | None |
| A0A395IVJ2 | 2-99 | None |
| A0A4Q3NTV2 | 133-234 | None |
| A0A3A4PT94 | 147-231 | None |
| A0A842NDF7 | 211-295 | None |
| A0A6L7P9L0 | 63-161 | None |
| A0A075FVV0 | 103-199 | None |
| A0A1V6K4D6 | 3-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.