DPCstruct | MC7622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V3HX63 | 61-159 | WGRKEMLENASELPFMRDFVLPPSDPLAPYFSALLRERFGFGSAYLVFHNEDAIAAFKANTRNNIIDVTDFVTDPKLEKEAVRVIKE… |
| A0A7J4CSF2 | 1-88 | MRDFVLPPSDPLAPYFADVLKQKFGFGSAYLVFKGAEPVAAFKANTRDKVIDVTDFVGEESGWRIVKEFAWEHQYPLKSQVRIAGKRI |
| A0A075FTQ1 | 109-207 | None |
| A0A7J4T5Q0 | 527-634 | None |
| A0A6V8DIQ5 | 159-256 | None |
| A0A7J4CZB7 | 481-577 | None |
| A0A843LF96 | 261-355 | None |
| A0A843FIQ1 | 105-179 | None |
| A0A1V4TV59 | 826-921 | None |
| A0A2E9L4P4 | 1141-1239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.