DPCstruct | MC7621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 118 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1WGM8 | 1-118 | MWLDEADGFAEIFKGYLPYYLLVALPIFIIMSPVNPVAASHEFSVYRMQQYDLHTVPHGCRSASFNLEGRSLTTWSTSRHCVVARVQ… |
| A0A5B7GFV7 | 1-136 | MFRAVRVNTTSFCQVLRSSVPYCLVVALPLLLLLSPVPVDAAAEFTVYRLQQYDLHGSAHGSRSSLVNVEARSLDAGSVGRRCVLAR… |
| A0A1D6QJU5 | 1-125 | None |
| A0A183QKZ7 | 1-112 | None |
| A0A4Z2D2K5 | 1-112 | None |
| A0A6J3R787 | 1-121 | None |
| A0A2H5QSW5 | 1-109 | None |
| A0A7J7JCL0 | 1-114 | None |
| A0A6J1VN64 | 7-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.