DPCstruct | MC762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9EM19 | 41-112 | KKTIDYASIRLGERNISLNGLEMELVKYINSHDIDVQFEDGTIVHHKNYTNFKKGYIPHPKYRICEHVGTFK |
| A0A374RF88 | 16-70 | HINHYKVGEKAVCSNNMIAEIIEYRNHKDIDVRYEDGYIIEHTTYQSFFQKAPLL |
| A0A849Y3C5 | 64-115 | None |
| R7BLT5 | 135-197 | None |
| A0A3R6FLN7 | 64-115 | None |
| A0A412LDZ4 | 386-438 | None |
| A0A3R6D7L2 | 169-224 | None |
| B7CCB5 | 382-434 | None |
| A0A1C5M2Q4 | 387-444 | None |
| C0B6S9 | 4-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.