DPCstruct | MC7617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 414 ± 41 aa |
| Standard deviation of domain lengths | 41.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6KBP6 | 14-469 | TWVDSRVQRKPLSKVDVLRDTAITYIDELWFNVTDNTVWTYNAQQEYGADSAMLLAFKELCDQLDRFVPAPISNRVTESIWNYARVQ… |
| A0A5B7G6K5 | 5-419 | EIALNTMEEYIRPINTLYRRFRLYQKMKDKIEDHTLMDFANTVVSHDTHSIMSLMAHLHSMAAPAASLRTSYLDEEMSVSALNDPRY… |
| A0A7R8X3Y9 | 3-371 | None |
| A0A835CSL2 | 58-479 | None |
| A0A835CKM8 | 29-488 | None |
| A0A834XMP7 | 143-600 | None |
| A0A6P5VEG3 | 44-429 | None |
| A0A0C9QGU1 | 34-502 | None |
| A0A5E4Q6X5 | 214-544 | None |
| A0A5E4Q6S5 | 13-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.