DPCstruct | MC7616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 157 ± 21 aa |
| Standard deviation of domain lengths | 21.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14959 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182G0X3 | 258-400 | DQLTSAQQLKLFTLLERYCLAAESLAFPFPLGFSSFFTYLGYRALSFDNFMQYVEHHVFELQIDVIKVIIADIDDSPEGVQRKLSLL… |
| A0A7R9EVK0 | 13-143 | FVLLERFYLAVNSLAFPLPQGFTSFFTFLGYRTLAFPTFLQYTQRNTFELQVDVMKAIMADMDDTTEGVRRKLRLLLLLPRSRAKRL… |
| A0A0N1PG89 | 12-154 | None |
| F0ZG18 | 900-1045 | None |
| A0A4Z2BFZ7 | 3-165 | None |
| A0A1S3IDL5 | 2-132 | None |
| A0A6P7FCC5 | 288-429 | None |
| F1Q517 | 2-153 | None |
| A0A3Q0JI81 | 234-420 | None |
| A0A210PEY3 | 800-997 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.