DPCstruct | MC7615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 40.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0FPK6 | 1-88 | MNKPNYKLAEGLVPANYVRQAVESRNTRENLVKTVLSQRRLPVGGWDDATIKLFLQDLSLMDSNNFNEYSGAGEREGRIESSLVRDMH |
| A0A5B7G0L0 | 1-89 | MDAESLRLAERFLPSTYLKQAQDADISRRSRIHQLLEKRKCPDEGWDDQMIEGLLVDLSKMDSNNFPANCGVGERESRIFSVIIITA… |
| A0A0S4MLS0 | 4-94 | None |
| A0A1W0A964 | 434-521 | None |
| A0A0V0XP62 | 1-88 | None |
| A0A1B0AKV0 | 10-89 | None |
| A0A418AQE7 | 142-226 | None |
| A0A183P5W7 | 1-89 | None |
| A0A0B1PPZ7 | 1-107 | None |
| A0A444U6Q5 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.