DPCstruct | MC7614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 54.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3SEP0 | 16-93 | GRYFTSFKVPDVYGVFQFKVEYERLGYTSLSLSKQIPVRPFRHNEYERFIPTAYPYYGASFSMMAGFLIFSAVHLYNK |
| A0A5B7FZE8 | 4-78 | SLWVQVPDVYGVYQFKVEYNRVGFTRLYSSTQVSVRPFTHLQYERFIECAYPYYASAFSMMVGVFLFSLVFLHHK |
| A0A817SRW6 | 177-255 | None |
| A0A0N4VIL9 | 1-78 | None |
| A0A438JTD3 | 729-794 | None |
| F1N632 | 468-545 | None |
| A0A0C9V4R2 | 57-134 | None |
| A0A482VC28 | 707-785 | None |
| A0A7S0Y977 | 167-238 | None |
| A0A183LS69 | 123-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.