DPCstruct | MC7613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 350 ± 43 aa |
| Standard deviation of domain lengths | 42.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182TMP7 | 1-293 | TGLGKAESSSRHFLYTEHFPLCQDDPISQHDCNQRYILLYGVGKERDEKKHAVKKMSKEICKLFSKKFSIDVAEGGKVKKHSRSEFN… |
| A0A5B7FYU8 | 1-439 | MCTLISRGDLATGTPDLKADSSFGEKKEDGTDNIDDDLGKILQKIAVNTSLEESGSGGRGELGVEGKQRPPRHLVYAQHFPLPQDDA… |
| A0A4U5NHH9 | 37-401 | None |
| A0A060WU58 | 1-310 | None |
| A0A0B1S532 | 154-498 | None |
| A0A1I7Z8Y9 | 246-606 | None |
| A0A158Q3L6 | 626-933 | None |
| A0A183CAR8 | 76-464 | None |
| A0A6V7UR35 | 686-1023 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.