DPCstruct | MC7611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 299 ± 43 aa |
| Standard deviation of domain lengths | 42.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FL47 | 6-288 | ADNNPCGQNILRLVSRGNAIIAELLRLKDYIPPVFRLETKQDQQKYGVIIYDFSYFKTSDDFDNKIENDPQLQDLDEEFRENYTEIL… |
| A0A5B7FVQ9 | 22-366 | KKMDLLAENNVCGQALLRLVARGNSIIAELMRLADYVPQVFRLETKAEQQKYGDIVLDFAYFKAADGFNKKIENSSVLMDIDDEIRE… |
| A0A200QGX5 | 12-348 | None |
| A0A0B1T8R3 | 11-304 | None |
| A0A6A4WMM3 | 1-252 | None |
| A0A6V7VKZ5 | 9-256 | None |
| K3YCJ5 | 22-341 | None |
| A0A1I7XP21 | 8-225 | None |
| A0A058Z0P3 | 2-347 | None |
| A0A4S8JX57 | 31-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.