DPCstruct | MC7610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 6.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536UC72 | 1-83 | MRIQAGGPVAGDVLKCQLKPVTTTNYTVTFTPAELVRLNMIFLQGVCDWTKPGIGQLLIADTWLRYFDPSGAWARMGHTSFGN |
| A0A5M8ANB5 | 310-376 | PRIAAGGPIAGDVMKCTLKPVNPADYSVPFTPDQLNRLRAIFPTGVCDWTQRGVNQTGVVPNGSFGP |
| A0A2V8KWF2 | 1-75 | None |
| A0A7V9VP41 | 69-139 | None |
| A0A2V8CFV6 | 165-226 | None |
| A0A6J5GS77 | 63-134 | None |
| A0A2V8TD11 | 133-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.