DPCstruct | MC761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6A3G3 | 4-89 | MRSHLIGSLALVSLIACTRKVVVVDSPPPRGRSTAVTLGVPPGHLPPPGQCRIWIPGRPPGRQPPARSCDGILAQAPAGAMILYRP |
| A0A0T6A1Z9 | 6-84 | MFLVLLSLVSLLTVGCAPVVVGEGPPPVVGPRALHVPPGHYPPPGHCRLWYPGRPPGHQPPPVPCERLIVGPGAFILYN |
| A0A6I7QGI8 | 19-108 | None |
| A0A1H7AUX8 | 170-255 | None |
| A0A4P5WGU4 | 16-85 | None |
| A0A3D3USK2 | 5-105 | None |
| A0A7W1BIR3 | 1-82 | None |
| A0A2V7EGD4 | 1-77 | None |
| A0A2G4FWD2 | 1-96 | None |
| A0A1E4B8G3 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.