DPCstruct | MC7608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 32 aa |
| Standard deviation of domain lengths | 32.14 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3NC71 | 6-77 | ASSWAYIQGRLRELGVSHYHLGPWGQEGGAYRFWCKVPMGEERLVARYFEAIDRDSAEAVNRVLAQIEAWRA |
| A0A432MPI1 | 1-87 | MRLASGKDDTPAKNAASEWSEIRRRMEELGVGRFWVEGEFGGPVTFRCVVPVIGDRAVSQHFEAEGQDLVSAAQDALRRIALWRATE |
| L0D733 | 217-325 | None |
| A0A7C3SF81 | 1-85 | None |
| A0A7V4M5U7 | 19-104 | None |
| A0A2E8FIH3 | 55-179 | None |
| A0A3E0Q9B9 | 103-230 | None |
| A0A3L7PX29 | 30-178 | None |
| A0A3M1S0R1 | 22-110 | None |
| A0A518CJZ1 | 300-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.