DPCstruct | MC7606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20213 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645FLB5 | 2-91 | AVTATLFNGYILPSAKLVEAGQTSESRMIDLLVILLLKIMARPHTDRITFNVSFDIDAGEGSESRLVQIIAAIGPDDSGEPVLTIML… |
| A0A432MLC2 | 9-127 | SRDRALADGVLIDVTEIVRDCRAEIPYPTAVSAGLWNHPLIERDPNKVRDAIERGVRSWIDAGRPAAGTFVNPVPMWVQEQPRSLDP… |
| A0A6M3LHU9 | 30-135 | None |
| B4CXN5 | 133-246 | None |
| A0A518AS33 | 16-146 | None |
| A0A4Y9TGA6 | 6-103 | None |
| A0A1I5WHY4 | 9-106 | None |
| A0A2W1Q0H3 | 12-127 | None |
| A0A0F9HHP7 | 1-92 | None |
| A0A7X7PDD8 | 26-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.