DPCstruct | MC7605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846PAX8 | 15-99 | APGPPGKSMSYAFEILDKVGSQEYTWWSIVYDIANRRIHFRTKTNPSIRFLDLAAFDFSCDQPVKTYDLDSKESGDVSEEFEDYS |
| A0A432MDM9 | 7-91 | TPFGISDPSRPNVAATLWRTASDQKNRRSYFETTRSPSIFWVDLAVIAFAEGRPARRRSLTGGEAYAGEASAPLQDARPFTLLEA |
| A0A427BQX0 | 72-136 | None |
| K0SB52 | 289-356 | None |
| A0A6V6Z5W1 | 48-141 | None |
| A0A812HB19 | 159-223 | None |
| A0A7X8LSR7 | 267-350 | None |
| A0A7I7SM15 | 15-91 | None |
| A0A7S2Q3Q8 | 10-87 | None |
| A0A7W0MNR6 | 68-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.