DPCstruct | MC7604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3727 |
|---|---|
| Mean domain length (aa) | 272 ± 55 aa |
| Standard deviation of domain lengths | 54.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.35 |
| Mean intra-cluster sequence similarity (%) | 12.60 |
| Pfam Score | 85.99 |
| Assigned Pfam label(s) | PF11797- PF14008- CL0020- PF10360- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432MD38 | 28-313 | ATAAAEPTPRHDAAAGGAGFRFAFLPDIHLMRERRGPVGMAACLAAVEKLDRKPAFIVTGGDLIDSLRFKDVREANELADLFVQIWN… |
| A0A0P0V8T5 | 19-222 | YSYRYPTPYKASGSTAPFWYSVKRASAYIIVLASYSSYGKYTPQYKWLEAEFPKVNRSETPWLIVLLHAPWYNSYNYHYMEGESMRV… |
| A0A239FC58 | 121-444 | None |
| A0A7K2AZI7 | 56-367 | None |
| A0A1J9R5J9 | 225-591 | None |
| A0A022R3K7 | 49-336 | None |
| K2S7U0 | 59-230 | None |
| A0A4R6WI48 | 29-306 | None |
| A0A068V7C6 | 94-266 | None |
| A0A0E0GNQ8 | 42-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.