DPCstruct | MC7603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 412 ± 42 aa |
| Standard deviation of domain lengths | 42.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661VIL2 | 33-454 | AAECVEEHHGDLIIEANEVLTIADETFCIDGNIIIEANGHLVIRNVTLVTDASSWTSLSVQQGGKLELSNVVLVANHGNGYWINARD… |
| A0A3M1BAV5 | 343-778 | AIVGDLTVDGNQSITLGDGRYMVYGNLTLKDNVTLTVGPHTALYISDLFLYDNAQLIVKGGYLLPAGPVFDPATAPPGAKVPGMLGA… |
| A0A6C2U1R4 | 428-809 | None |
| A0A7V0JUL0 | 128-575 | None |
| A0A5C6D602 | 312-688 | None |
| A0A7J2LQH9 | 1-421 | None |
| A0A0F9VRX0 | 364-727 | None |
| A0A2N8M951 | 125-502 | None |
| A0A1F5DAH3 | 101-526 | None |
| A0A1G1XTV0 | 204-639 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.