DPCstruct | MC7600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6XEU5 | 34-121 | DYWRQGDLYITLLDELPSGLTETNERQLAPGTTQGSRHIVEGGATVYDQDSDALTGPVVEVTGRAVITHPEHGNVALPTGSYAITYQR |
| A0A2V8NDG5 | 13-114 | KWYQQGDVTIKPVAAIPDGASPVSSRVLAEGEATGHKHRAEAEDVLLFMHEDALYMRVPSDTRIVHEEHHALAIPPGDYLIGKVREY… |
| A0A0F9CFX3 | 1-107 | None |
| A0A7C5ZKF6 | 1-106 | None |
| A0A842VXL1 | 1-102 | None |
| A0A372GN02 | 29-135 | None |
| A0A0F9AI59 | 2-120 | None |
| A0A2E2B5R3 | 37-159 | None |
| A0A5P8VZ96 | 49-144 | None |
| A0A5C7PXW5 | 7-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.