DPCstruct | MC760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7J4E4 | 1-74 | MAKSPCPVSLSQFQEKAEPLKVVINGQEHIAEVKAFSTGSFGWYINGKTTVTIDGKPVSVQIGMNLTVVGSKEA |
| A0A023AYS8 | 148-213 | PMTKAQFMDNAVTFKSQIGPVEFDLAPRKFSTGSCGWFYGSKHDLMVGDVPVTCRFTLNCIALGSK |
| A0A3R7CLR2 | 3-71 | None |
| F4RDY3 | 39-118 | None |
| A0A813JTQ2 | 145-216 | None |
| A0A2H6KCH1 | 139-206 | None |
| A0A1Y1Y154 | 53-133 | None |
| A0A2N5W691 | 37-114 | None |
| A0A517Y396 | 10-80 | None |
| A0A813GR88 | 213-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.