DPCstruct | MC76
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098QV42 | 201-322 | PLRFGQFLYYCRVISWDNLIGALLEQRRERVNFGTTAVDLGLLSSTGVQTLGRHLRPGIFIGVTAQNLGLLTTRDVQKVLAVQRSRS… |
| A0A3D2TKS0 | 20-134 | MHFGEYLVRENILSAHQILKALDEQRKRRKFIPLLLVELGMMDDHRALKLCTISNEDHKDVLDIMREEGIISQQQSNRIRIARDKSG… |
| A0A5B9P684 | 5-128 | None |
| A0A2M8B6A4 | 162-290 | None |
| A0A517NVV3 | 20-134 | None |
| A0A1F9LU89 | 165-287 | None |
| A0A1G0XVT9 | 2-116 | None |
| A0A2E3XUF0 | 2-125 | None |
| A0A355G7B5 | 236-355 | None |
| A0A1V5XML0 | 91-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.