DPCstruct | MC7599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 301 ± 55 aa |
| Standard deviation of domain lengths | 54.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8MYH6 | 63-343 | IECDFAGLDESTKKWELKKALSSKIVPSLYYLSRKLHEDCPYLQNRRSALCLSGGGVRSAVFNLGILQGLARAGLLSQFDYLSTVSG… |
| A0A7W3TM38 | 3-323 | AATDGTPAADFATVEAAEHDWIARRRAAIDRPPRHEDCVGLGLSGGGIRSATFNLGVIEALDRAGLMRDVDYLSTVSGGGYIGACYS… |
| A0A1M7P8Z0 | 35-302 | None |
| A0A7Z0TK12 | 2-311 | None |
| A0A7G5ZAI9 | 79-335 | None |
| A0A0L6CK37 | 182-451 | None |
| A0A2U8W6X8 | 2-268 | None |
| A0A7V9AR00 | 4-293 | None |
| A0A1B2HVH6 | 15-342 | None |
| A0A3M6V614 | 12-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.