DPCstruct | MC7597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 312 ± 42 aa |
| Standard deviation of domain lengths | 42.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19614 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4EKM3 | 8-251 | EDATVSLRKQSSTLCEFLNETGLQVFFEMDAVMIPPAMLLKPDRTIPPFDRTKLIALDWTGISLSVESQGVERRPDSVQARTIKHVR… |
| A0A1F9RFF2 | 25-270 | DVRVLKTHRLKLCDEAGLPKQDFHIYKCLLCDVASENSGPAYHLCDGNWYCIDKNYVARLKADLDPYFLTTDLPELTSGSEGDYNQR… |
| A0A7U8V9Y2 | 188-531 | None |
| A0A6M1YHG9 | 114-511 | None |
| A0A4R6KJS8 | 63-402 | None |
| A0A1Y6FAI5 | 203-542 | None |
| A0A4R0JVJ8 | 144-489 | None |
| I6T405 | 86-448 | None |
| A0A840GV92 | 39-356 | None |
| F2LAF3 | 8-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.